PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 357aa    MW: 40889.6 Da    PI: 10.0415
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48368.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
       KHN48368.1  4 RQRWRAEEDALLRSYVKQYGPREWNLVSQRMNtyLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding35.42.4e-1159103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
       KHN48368.1  59 KGSLTEEEQRLVIHLQAKYGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.22153IPR017930Myb domain
SMARTSM007175.7E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.03E-21498IPR009057Homeodomain-like
CDDcd001671.95E-8653No hitNo description
Gene3DG3DSA:1.10.10.608.9E-21660IPR009057Homeodomain-like
PfamPF139211.4E-14768No hitNo description
PROSITE profilePS5129423.3554108IPR017930Myb domain
SMARTSM007173.8E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-1561102IPR009057Homeodomain-like
CDDcd001677.06E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKERQRWRAE EDALLRSYVK QYGPREWNLV SQRMNTYLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IHLQAKYGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE KKEINRIADP  120
INNSKYEHIL ESFAEKLVKE RPSPSFVMAA SDGAFLLTDT PAPASSLRPS WLSNSSSAAA  180
IGPSSLSVKL SLSSSTVATP PFSWLPPERG PDNAPFVLGN VSALHGAIPT LSDSMHMSQM  240
VEHCKELEEG HRALATHKKE AAWRLSRVEL QLESEKANRR REKIEEFEAK IKALQEEEKA  300
ALGRIEAEYR EQLAALRRDA ENKEQKLAEQ WDAKHLRFTR LLEQLGCRAG LLEPNAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-16792789MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-16792789C-Myb DNA-Binding Domain
1msf_C3e-16792789C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7902530.0AY790253.1 Glycine max phantastica transcription factor b (PHANb) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235251.10.0phantastica transcription factor b
RefseqXP_006576134.10.0PREDICTED: phantastica transcription factor b isoform X1
RefseqXP_014628828.10.0PREDICTED: phantastica transcription factor b isoform X1
SwissprotO809311e-143AS1_ARATH; Transcription factor AS1
TrEMBLA0A0B2STX30.0A0A0B2STX3_GLYSO; Transcription factor AS1
TrEMBLQ4VPE50.0Q4VPE5_SOYBN; Phantastica transcription factor b
STRINGGLYMA03G19030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-123MYB family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]